PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BS_DBAD99848.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 201aa    MW: 22659.9 Da    PI: 6.945
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BS_DBAD99848.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB155.11.2e-4822117196
                  NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 
                            vreqdr++Pianv+rim+++lPa+akis+dake +qecvsefisfvt+ea+++c+ e+rkt+n++d++wal  lGf+dyv pl+v+l+
  Traes_7BS_DBAD99848.1  22 VREQDRLMPIANVIRIMRRALPAHAKISDDAKEAIQECVSEFISFVTGEANERCHMEHRKTVNAEDIVWALNRLGFDDYVVPLSVFLH 109
                            69************************************************************************************** PP

                  NF-YB  89 kyrelege 96 
                            + r+ e++
  Traes_7BS_DBAD99848.1 110 RMRDPEAA 117
                            ***98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.7E-4518118IPR009072Histone-fold
SuperFamilySSF471133.73E-3425116IPR009072Histone-fold
PfamPF008087.6E-252992IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.4E-155674No hitNo description
PROSITE patternPS0068505975IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.4E-157593No hitNo description
PRINTSPR006157.4E-1594112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MENADVPNGA AAPAPTQATP VVREQDRLMP IANVIRIMRR ALPAHAKISD DAKEAIQECV  60
SEFISFVTGE ANERCHMEHR KTVNAEDIVW ALNRLGFDDY VVPLSVFLHR MRDPEAATGA  120
AXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXRVQ VQNQMQRPVY ASPAPMQVQN  180
QVQRPMYAPP APVQVQMQRG V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A6e-3922113293NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9027851e-159GU902785.1 Triticum monococcum nuclear transcription factor Y subunit B1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966908.19e-55PREDICTED: nuclear transcription factor Y subunit B-10-like
SwissprotQ84W667e-52NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLW5HWG11e-111W5HWG1_WHEAT; Uncharacterized protein
STRINGSi008357m4e-54(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.29e-53nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]